Online Services

●I-TASSER ●I-TASSER-MTD ●C-I-TASSER ●CR-I-TASSER ●QUARK ●C-QUARK ●LOMETS ●MUSTER ●CEthreader ●SEGMER ●DeepFold ●DeepFoldRNA ●FoldDesign ●COFACTOR ●COACH ●MetaGO ●TripletGO ●IonCom ●FG-MD ●ModRefiner ●REMO ●DEMO ●DEMO-EM ●SPRING ●COTH ●Threpp ●PEPPI ●BSpred ●ANGLOR ●EDock ●BSP-SLIM ●SAXSTER ●FUpred ●ThreaDom ●ThreaDomEx ●EvoDesign ●BindProf ●BindProfX ●SSIPe ●GPCR-I-TASSER ●MAGELLAN ●ResQ ●STRUM ●DAMpred

●TM-score ●TM-align ●US-align ●MM-align ●RNA-align ●NW-align ●LS-align ●EDTSurf ●MVP ●MVP-Fit ●SPICKER ●HAAD ●PSSpred ●3DRobot ●MR-REX ●I-TASSER-MR ●SVMSEQ ●NeBcon ●ResPRE ●TripletRes ●DeepPotential ●WDL-RF ●ATPbind ●DockRMSD ●DeepMSA ●FASPR ●EM-Refiner ●GPU-I-TASSER

●BioLiP ●E. coli ●GLASS ●GPCR-HGmod ●GPCR-RD ●GPCR-EXP ●Tara-3D ●TM-fold ●DECOYS ●POTENTIAL ●RW/RWplus ●EvoEF ●HPSF ●THE-DB ●ADDRESS ●Alpaca-Antibody ●CASP7 ●CASP8 ●CASP9 ●CASP10 ●CASP11 ●CASP12 ●CASP13 ●CASP14

Structure of PDB 6j5t Chain A Binding Site BS01

Receptor Information >6j5t Chain A (length=195) Species: 3702 (Arabidopsis thaliana) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure] KEWLTEVNYLGQLSHPNLVLLVGYCAEGENRLLVYEFMPKGSLENHLFRR GAQPLTWAIRMKVAVGAAKGLTFLHEAKSQVIYRDFKAANILLDADFNAK LSDFTHVSTKVIGTHGYAAPEYVATGRLTAKSDVYSFGVVLLELISGRLF RIMDTKLGGQYPQKGAFTAANLALQCLNPDAKLRPKMSEVLVTLE

Ligand information Ligand ID U5P InChI InChI=1S/C9H13N2O9P/c12-5-1-2-11(9(15)10-5)8-7(14)6(13)4(20-8)3-19-21(16,17)18/h1-2,4,6-8,13-14H,3H2,(H,10,12,15)(H2,16,17,18)/t4-,6-,7-,8-/m1/s1 InChIKey DJJCXFVJDGTHFX-XVFCMESISA-N SMILES Software SMILES ACDLabs 10.04 O=C1NC(=O)N(C=C1)C2OC(C(O)C2O)COP(=O)(O)O CACTVS 3.341 O[CH]1[CH](O)[CH](O[CH]1CO[P](O)(O)=O)N2C=CC(=O)NC2=O OpenEye OEToolkits 1.5.0 C1=CN(C(=O)NC1=O)[C@H]2[C@@H]([C@@H]([C@H](O2)COP(=O)(O)O)O)O OpenEye OEToolkits 1.5.0 C1=CN(C(=O)NC1=O)C2C(C(C(O2)COP(=O)(O)O)O)O CACTVS 3.341 O[C@H]1[C@@H](O)[C@@H](O[C@@H]1CO[P](O)(O)=O)N2C=CC(=O)NC2=O Formula C9 H13 N2 O9 P Name URIDINE-5'-MONOPHOSPHATE ChEMBL CHEMBL214393 DrugBank DB03685 ZINC ZINC000002123545 PDB chain 6j5t Chain A Residue 501 [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

Receptor-Ligand Complex Structure Global view Local view Structure summary [Spin on] [Spin off] [Reset] [High quality] [Low quality] [White background] [Black background] [Spin on] [Spin off] [Reset] [High quality] [Low quality] [White background] [Black background] PDB 6j5t Reconstitution and structure of a plant NLR resistosome conferring immunity. Resolution 3.4 Å Binding residue (original residue number in PDB) H251 S253 Binding residue (residue number reindexed from 1) H106 S108 Annotation score 2

Enzymatic activity Catalytic site (original residue number in PDB) D219 A223 N224 D237 Catalytic site (residue number reindexed from 1) D85 A89 N90 D103 Enzyme Commision number 2.7.11.1: non-specific serine/threonine protein kinase.

Gene Ontology Molecular Function GO:0004672 protein kinase activity GO:0004674 protein serine/threonine kinase activity GO:0005515 protein binding GO:0005524 ATP binding GO:0030957 Tat protein binding GO:0044024 histone H2AS1 kinase activity GO:0106310 protein serine kinase activity

	Biological Process
GO:0006338	chromatin remodeling
GO:0006468	protein phosphorylation
GO:0006952	defense response
GO:0016310	phosphorylation
GO:1900426	positive regulation of defense response to bacterium

	Cellular Component
GO:0005634	nucleus
GO:0005886	plasma membrane
GO:0009507	chloroplast

View graph for Molecular Function

View graph for Biological Process

View graph for Cellular Component