Structure of PDB 2a6o Chain A Binding Site BS01

Receptor Information

>2a6o Chain A (length=152) Species: 210 (Helicobacter pylori) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

AVLYKSNHNVVYSCKYHIVWCPKYRRKVLVGAVEMRLKEIIQEVAKELRV
EIIEMQTDKDHIHILADIDPSFGVMKFIKTAKGRSSRILRQEFNHLKTKL
PTLWTNSCFISTVGGAPLNVVKQYIENQQNSNRPKQKEKWKSYVDNLQTK
AL

Ligand information

>2a6o Chain C (length=22) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

cccctagctttagctatgggga

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	2a6o Active site sharing and subterminal hairpin recognition in a new class of DNA transposases.
Resolution	2.6 Å
Binding residue (original residue number in PDB)	M78 K82 K85 G86 R87 S89 R90 R93 T105 W107
Binding residue (residue number reindexed from 1)	M75 K79 K82 G83 R84 S86 R87 R90 T102 W104

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003677	DNA binding
GO:0004803	transposase activity
GO:0046872	metal ion binding

	Biological Process
GO:0006313	DNA transposition

View graph for
Molecular Function

View graph for
Biological Process

External links

PDB	RCSB:2a6o, PDBe:2a6o, PDBj:2a6o
PDBsum	2a6o
PubMed	16209952
UniProt	Q933Z0

[Back to BioLiP]

zhanglab

zhanggroup.org | +65-6601-1241 | Computing 1, 13 Computing Drive, Singapore 117417