Online Services

●I-TASSER ●I-TASSER-MTD ●C-I-TASSER ●CR-I-TASSER ●QUARK ●C-QUARK ●LOMETS ●MUSTER ●CEthreader ●SEGMER ●DeepFold ●DeepFoldRNA ●FoldDesign ●COFACTOR ●COACH ●MetaGO ●TripletGO ●IonCom ●FG-MD ●ModRefiner ●REMO ●DEMO ●DEMO-EM ●SPRING ●COTH ●Threpp ●PEPPI ●BSpred ●ANGLOR ●EDock ●BSP-SLIM ●SAXSTER ●FUpred ●ThreaDom ●ThreaDomEx ●EvoDesign ●BindProf ●BindProfX ●SSIPe ●GPCR-I-TASSER ●MAGELLAN ●ResQ ●STRUM ●DAMpred

●TM-score ●TM-align ●US-align ●MM-align ●RNA-align ●NW-align ●LS-align ●EDTSurf ●MVP ●MVP-Fit ●SPICKER ●HAAD ●PSSpred ●3DRobot ●MR-REX ●I-TASSER-MR ●SVMSEQ ●NeBcon ●ResPRE ●TripletRes ●DeepPotential ●WDL-RF ●ATPbind ●DockRMSD ●DeepMSA ●FASPR ●EM-Refiner ●GPU-I-TASSER

●BioLiP ●E. coli ●GLASS ●GPCR-HGmod ●GPCR-RD ●GPCR-EXP ●Tara-3D ●TM-fold ●DECOYS ●POTENTIAL ●RW/RWplus ●EvoEF ●HPSF ●THE-DB ●ADDRESS ●Alpaca-Antibody ●CASP7 ●CASP8 ●CASP9 ●CASP10 ●CASP11 ●CASP12 ●CASP13 ●CASP14

Structure of PDB 1yso Chain A Binding Site BS01

Receptor Information >1yso Chain A (length=153) Species: 5476 (Candida albicans) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure] VQAVAVLKGDAGVSGVVKFEQASESEPTTVSYEIAGNSPNAERGFHIHEF GDATNGCVSAGPHFNPFKKTHGAPTDEVRHVGDMGNVKTDENGVAKGSFK DSLIKLIGPTSVVGRSVVIHAGQDDLGKGDTEESLKTGNAGPRPACGVIG LTN

Ligand information Ligand ID CU1 InChI InChI=1S/Cu/q+1 InChIKey VMQMZMRVKUZKQL-UHFFFAOYSA-N SMILES Software SMILES ACDLabs 10.04 CACTVS 3.341 OpenEye OEToolkits 1.5.0 [Cu+] Formula Cu Name COPPER (I) ION ChEMBL DrugBank ZINC PDB chain 1yso Chain A Residue 154 [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

Receptor-Ligand Complex Structure Global view Local view Structure summary [Spin on] [Spin off] [Reset] [High quality] [Low quality] [White background] [Black background] [Spin on] [Spin off] [Reset] [High quality] [Low quality] [White background] [Black background] PDB 1yso Unusual trigonal-planar copper configuration revealed in the atomic structure of yeast copper-zinc superoxide dismutase. Resolution 1.73 Å Binding residue (original residue number in PDB) H46 H48 H63 H120 Binding residue (residue number reindexed from 1) H46 H48 H63 H120 Annotation score 1

Enzymatic activity Catalytic site (original residue number in PDB) H46 H48 H63 H71 H80 D83 H120 R143 Catalytic site (residue number reindexed from 1) H46 H48 H63 H71 H80 D83 H120 R143 Enzyme Commision number 1.15.1.1: superoxide dismutase.

Gene Ontology Molecular Function GO:0004784 superoxide dismutase activity GO:0005507 copper ion binding GO:0005515 protein binding GO:0008270 zinc ion binding GO:0016209 antioxidant activity GO:0016491 oxidoreductase activity GO:0016670 oxidoreductase activity, acting on a sulfur group of donors, oxygen as acceptor GO:0046872 metal ion binding

	Biological Process
GO:0006801	superoxide metabolic process
GO:0006878	intracellular copper ion homeostasis
GO:0006882	intracellular zinc ion homeostasis
GO:0015680	protein maturation by copper ion transfer
GO:0019430	removal of superoxide radicals
GO:0031505	fungal-type cell wall organization
GO:0034599	cellular response to oxidative stress
GO:0045944	positive regulation of transcription by RNA polymerase II
GO:0050821	protein stabilization
GO:1901856	negative regulation of cellular respiration
GO:1990748	cellular detoxification

	Cellular Component
GO:0005634	nucleus
GO:0005737	cytoplasm
GO:0005739	mitochondrion
GO:0005758	mitochondrial intermembrane space
GO:0005829	cytosol
GO:1902693	superoxide dismutase complex

View graph for Molecular Function

View graph for Biological Process

View graph for Cellular Component