Online Services

●I-TASSER ●I-TASSER-MTD ●C-I-TASSER ●CR-I-TASSER ●QUARK ●C-QUARK ●LOMETS ●MUSTER ●CEthreader ●SEGMER ●DeepFold ●DeepFoldRNA ●FoldDesign ●COFACTOR ●COACH ●MetaGO ●TripletGO ●IonCom ●FG-MD ●ModRefiner ●REMO ●DEMO ●DEMO-EM ●SPRING ●COTH ●Threpp ●PEPPI ●BSpred ●ANGLOR ●EDock ●BSP-SLIM ●SAXSTER ●FUpred ●ThreaDom ●ThreaDomEx ●EvoDesign ●BindProf ●BindProfX ●SSIPe ●GPCR-I-TASSER ●MAGELLAN ●ResQ ●STRUM ●DAMpred

●TM-score ●TM-align ●US-align ●MM-align ●RNA-align ●NW-align ●LS-align ●EDTSurf ●MVP ●MVP-Fit ●SPICKER ●HAAD ●PSSpred ●3DRobot ●MR-REX ●I-TASSER-MR ●SVMSEQ ●NeBcon ●ResPRE ●TripletRes ●DeepPotential ●WDL-RF ●ATPbind ●DockRMSD ●DeepMSA ●FASPR ●EM-Refiner ●GPU-I-TASSER

●BioLiP ●E. coli ●GLASS ●GPCR-HGmod ●GPCR-RD ●GPCR-EXP ●Tara-3D ●TM-fold ●DECOYS ●POTENTIAL ●RW/RWplus ●EvoEF ●HPSF ●THE-DB ●ADDRESS ●Alpaca-Antibody ●CASP7 ●CASP8 ●CASP9 ●CASP10 ●CASP11 ●CASP12 ●CASP13 ●CASP14

Structure of PDB 1jpl Chain A Binding Site BS01

Receptor Information >1jpl Chain A (length=161) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure] AMGSMAEAEGESLESWLNKATNPSNRQEDWEYIIGFCDQINKELEGPQIA VRLLAHKIQSPQEWEALQALTVLEACMKNCGRRFHNEVGKFRFLNELIKV VSPKYLGDRVSEKVKTKVIELLYSWTMALPEEAKIKDAYHMLKRQGIVQS DPPIPVDRTLI

Ligand information >1jpl Chain E (length=8) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure] SDEDLLHI

Receptor-Ligand Complex Structure Global view Local view Structure summary [Spin on] [Spin off] [Reset] [High quality] [Low quality] [White background] [Black background] [Spin on] [Spin off] [Reset] [High quality] [Low quality] [White background] [Black background] PDB 1jpl Structural basis for acidic-cluster-dileucine sorting-signal recognition by VHS domains. Resolution 2.4 Å Binding residue (original residue number in PDB) K86 F87 R88 N91 I94 K95 S98 Y101 K130 M137 Q141 Binding residue (residue number reindexed from 1) K90 F91 R92 N95 I98 K99 S102 Y105 K134 M141 Q145

Enzymatic activity Enzyme Commision number ?

Gene Ontology Molecular Function GO:0031267 small GTPase binding GO:0035091 phosphatidylinositol binding GO:0043130 ubiquitin binding

	Biological Process
GO:0006886	intracellular protein transport

	Cellular Component
GO:0005802	trans-Golgi network

View graph for Molecular Function

View graph for Biological Process

View graph for Cellular Component