Online Services

●I-TASSER ●I-TASSER-MTD ●C-I-TASSER ●CR-I-TASSER ●QUARK ●C-QUARK ●LOMETS ●MUSTER ●CEthreader ●SEGMER ●DeepFold ●DeepFoldRNA ●FoldDesign ●COFACTOR ●COACH ●MetaGO ●TripletGO ●IonCom ●FG-MD ●ModRefiner ●REMO ●DEMO ●DEMO-EM ●SPRING ●COTH ●Threpp ●PEPPI ●BSpred ●ANGLOR ●EDock ●BSP-SLIM ●SAXSTER ●FUpred ●ThreaDom ●ThreaDomEx ●EvoDesign ●BindProf ●BindProfX ●SSIPe ●GPCR-I-TASSER ●MAGELLAN ●ResQ ●STRUM ●DAMpred

●TM-score ●TM-align ●US-align ●MM-align ●RNA-align ●NW-align ●LS-align ●EDTSurf ●MVP ●MVP-Fit ●SPICKER ●HAAD ●PSSpred ●3DRobot ●MR-REX ●I-TASSER-MR ●SVMSEQ ●NeBcon ●ResPRE ●TripletRes ●DeepPotential ●WDL-RF ●ATPbind ●DockRMSD ●DeepMSA ●FASPR ●EM-Refiner ●GPU-I-TASSER

●BioLiP ●E. coli ●GLASS ●GPCR-HGmod ●GPCR-RD ●GPCR-EXP ●Tara-3D ●TM-fold ●DECOYS ●POTENTIAL ●RW/RWplus ●EvoEF ●HPSF ●THE-DB ●ADDRESS ●Alpaca-Antibody ●CASP7 ●CASP8 ●CASP9 ●CASP10 ●CASP11 ●CASP12 ●CASP13 ●CASP14

Structure of PDB 1e02 Chain A Binding Site BS01

Receptor Information >1e02 Chain A (length=149) Species: 9823 (Sus scrofa) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure] PFELSGKWITSYIGSSDLEKIGENAPFQVFMRSIEFDDKESKVYLNFFSK ENGICEEFSLIGTKQEGNTYDVNYAGNNKFVVSYASETALIISNINVDEE GDKTIMTGLLGKGTDIEDQDLEKFKEVTRENGIPEENIVNIIERDDCPA

Ligand information Ligand ID UNA InChI InChI=1S/C11H22O/c1-2-3-4-5-6-7-8-9-10-11-12/h11H,2-10H2,1H3 InChIKey KMPQYAYAQWNLME-UHFFFAOYSA-N SMILES Software SMILES ACDLabs 10.04 O=CCCCCCCCCCC CACTVS 3.341 OpenEye OEToolkits 1.5.0 CCCCCCCCCCC=O Formula C11 H22 O Name UNDECANAL ChEMBL CHEMBL1236576 DrugBank DB04093 ZINC ZINC000001595727 PDB chain 1e02 Chain A Residue 600 [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

Receptor-Ligand Complex Structure Global view Local view Structure summary [Spin on] [Spin off] [Reset] [High quality] [Low quality] [White background] [Black background] [Spin on] [Spin off] [Reset] [High quality] [Low quality] [White background] [Black background] PDB 1e02 Complexes of Porcine Odorant Binding Protein with Odorant Molecules Belonging to Different Chemical Classes Resolution 2.15 Å Binding residue (original residue number in PDB) V37 M39 L53 L118 Binding residue (residue number reindexed from 1) V29 M31 L45 L110 Annotation score 1 Binding affinity MOAD: ic50=0.7uM PDBbind-CN: -logKd/Ki=6.15,IC50=0.7uM

Enzymatic activity Enzyme Commision number ?

Gene Ontology Molecular Function GO:0005549 odorant binding GO:0036094 small molecule binding

	Biological Process
GO:0007608	sensory perception of smell

	Cellular Component
GO:0005576	extracellular region
GO:0005615	extracellular space

View graph for Molecular Function

View graph for Biological Process

View graph for Cellular Component